Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)


Input alignment information:
Query sequenceDCIISRYKDGDVNNMYTANRNEEITIE-EYKVFVNEACHPYPVILPDRSVLSGDFTSAYADDDESC------------------------------------------------------------------------------------------------------------------------------------------------------
3GNZ Chain:P ((1-213))-AVINHDAVPVWPQPEPADATQALAVRFKPQLDVVNGCQPYPAVDPQGNTSGGLKPSQ----AAACRDMSKAQVYSRSGTYNGYYAIMYSWYMPKDSPSTGIGHRHDWENVVVWLDNAASANIVALSASAHSGYKKSFPADKSYLDGITAKISYKSTWPLDHELGFTTSAGKQQPLIQWEQMTQAARDALESTDFGNANVPFKSNFQDKLVKAFFQ


General information:
TITO was launched using:
RESULT:

Template: 3GNZ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output 		Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 107 1632 15.25 27.19
target 2D structure prediction score : 0.72
Monomeric hydrophicity matching model chain P : 0.57

3D Compatibility (PKB) : 15.25
2D Compatibility (Sec. Struct. Predict.) : 0.72
1D Compatibility (Hydrophobicity) : 0.57
QMean score : 0.244

(partial model without unconserved sides chains):
PDB file : Tito_3GNZ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3GNZ-query.scw
PDB file : Tito_Scwrl_3GNZ.pdb: