Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence AILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKLDSPE--RNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVF 4Y5U Chain:A ((429-517)) -IIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLY

General information: TITO was launched using: RESULT: Template: 4Y5U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 281 -10916 -38.85 -141.77 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.85 3D Compatibility (PKB) : -38.85 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.505

(partial model without unconserved sides chains): PDB file : Tito_4Y5U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4Y5U-query.scw PDB file : Tito_Scwrl_4Y5U.pdb: