Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKMLAQLQNRFDQWVEQIVQYLDRLSVRERIMVVFTTIFVVVVIVGYSLWKMHSLAEQQQKRLNDLKDLMVWMQSNAVTMKPANELELDKSGKIQRVAQQQGLTVSSQQNGEQ--LQIVVTHQNYAILANFLIQLA--QMGLSIQKMEMVSSEGQIKLTATV 1W2I Chain:B ((16-78)) --------------------------------------------------------------------------------------GVGFRWSMQREARKLGVNGW-VRNLPDGSVEAVLE-GDEERVEALIGWAHQGPPLARVTRVEVKW-----------

General information: TITO was launched using: RESULT: Template: 1W2I.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 187 -159 -0.85 -2.69 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain B : 0.53 3D Compatibility (PKB) : -0.85 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.551

(partial model without unconserved sides chains): PDB file : Tito_1W2I.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1W2I-query.scw PDB file : Tito_Scwrl_1W2I.pdb: