Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGLRWTDTIDIAIELSEAHPEVDPQWIRFTDLHAWVCALPDFSDDPNKLTEGLLEAIQMAWLDEVR 2LVN Chain:C ((457-495)) -------LNAMAHQIQEMFPQVPYHLVL--------QDLQLT-RSVEITTDNILE-----------

General information: TITO was launched using: RESULT: Template: 2LVN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 117 -15255 -130.38 -391.14 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain C : 0.57 3D Compatibility (PKB) : -130.38 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.700

(partial model without unconserved sides chains): PDB file : Tito_2LVN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LVN-query.scw PDB file : Tito_Scwrl_2LVN.pdb: