Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)


Input alignment information:
Query sequenceMNKSELIDAIA-EKGGVSKTDAGKALDATIASITEALKKGDTVTLVGFGTFSVKERAARTGRNPKTGEELQIKATKVPSFKAGKGLKDSVA
2HT0 Chain:B ((1-88))MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRD---


General information:
TITO was launched using:
RESULT:

Template: 2HT0.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output 		Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 189 17546 92.84 201.68
target 2D structure prediction score : 0.64
Monomeric hydrophicity matching model chain B : 0.84

3D Compatibility (PKB) : 92.84
2D Compatibility (Sec. Struct. Predict.) : 0.64
1D Compatibility (Hydrophobicity) : 0.84
QMean score : 0.558

(partial model without unconserved sides chains):
PDB file : Tito_2HT0.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2HT0-query.scw
PDB file : Tito_Scwrl_2HT0.pdb: