Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTNKKNLGIGGIIVLLIAAYLGLDLSGHKNNPTPSSIPVNQRTETTFSNDGVDTIKAAYERRQSNVQVQGSGRVKAILREDNDGSRHQKFILVLKNGL-SILVAHNIDLAPKIEDLRKGDIVEFNGEYEYNEKGGVLHWTHHDPQNRHENGWLKHNGRIYQ 3MXN Chain:B ((57-114)) ---------------------------------------------------------------DLAAVWMQGRVVMAD----------RGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQAC------------------------------

General information: TITO was launched using: RESULT: Template: 3MXN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 191 -11668 -61.09 -204.70 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : -61.09 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.438

(partial model without unconserved sides chains): PDB file : Tito_3MXN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3MXN-query.scw PDB file : Tito_Scwrl_3MXN.pdb: