Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDVDILNKTKAYAPITDKYLSGYTFSEETGTDSYLKENELFMGDIFMWDDSMKSTVMLNFGESVKDIMKRKGITQEQLAFDLGVDRSTLREYLDPDKQFTLAHVVGICIALKLPYDISEMMVSKAGLSLNGRMRHHIVYRGFLRVANTL 4I6U Chain:A ((10-75)) ---------------------------------------------------------SKVSFVIKKIRLEKGMTQEDLAYKSNLDRTFISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLI--------------------------

General information: TITO was launched using: RESULT: Template: 4I6U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 224 -38114 -170.15 -577.48 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -170.15 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.701

(partial model without unconserved sides chains): PDB file : Tito_4I6U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4I6U-query.scw PDB file : Tito_Scwrl_4I6U.pdb: