Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMSLFISTAHAAPAAAQSPGLLPNI-----LMIVVFVAIFYFLIWRPQAKR---------AKEHRSLI----ESLGVGSEVVFAGG---LMGKVTKLEGDYAVVELN-RGVEVKIQRASVISVL-PEGTLNNL
5MSM Chain:B ((2-133))PSVDIDASQWQKLTQSREKQTTVITPLGMMMLEIQGELELPKDFASLARRDSPNEGRFSEQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPMGIMHFNSKDNKVELVDVMKYKVIFKDRPLPIM


General information:
TITO was launched using:
RESULT:

Template: 5MSM.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 230 2052 8.92 18.83
target 2D structure prediction score : 0.34
Monomeric hydrophicity matching model chain B : 0.68

3D Compatibility (PKB) : 8.92
2D Compatibility (Sec. Struct. Predict.) : 0.34
1D Compatibility (Hydrophobicity) : 0.68
QMean score : 0.398

(partial model without unconserved sides chains):
PDB file : Tito_5MSM.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5MSM-query.scw
PDB file : Tito_Scwrl_5MSM.pdb: