Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-------------------------KCNISILKDGKYFTQ----KQEIAGW-------TVKFHDLDGN-----YVGKCKNAHTYACTYVTCE----DLAP---GYSPGKSKDVVASG-------NVGSLGHDPSSSSPSSP--------
1P5U Chain:B ((1-149))ADLTASTTRTATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ


General information:
TITO was launched using:
RESULT:

Template: 1P5U.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 135 2089 15.47 24.29
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain B : 0.66

3D Compatibility (PKB) : 15.47
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.66
QMean score : 0.162

(partial model without unconserved sides chains):
PDB file : Tito_1P5U.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1P5U-query.scw
PDB file : Tito_Scwrl_1P5U.pdb: