Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYYLPVDFYRYLIGREDQSVNEQVMIKCIDQQLKVNRLLIDQLDLSQVSHPKMREYLLNHIELTTVISSTLLNRSGTAEHLAKKRQLWTYIQQKNPEVFQAIRKTMLSRLTKHSVLPDRKLSNVVYQITKSVYGFN 2UWJ Chain:F ((1-32)) ---------------------------------------------------------------------------------MHKINKWSVIYNINSTVTRALRDLMQGILQKI-----------------------

General information: TITO was launched using: RESULT: Template: 2UWJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 21 -5723 -272.50 -178.83 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain F : 0.53 3D Compatibility (PKB) : -272.50 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.625

(partial model without unconserved sides chains): PDB file : Tito_2UWJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2UWJ-query.scw PDB file : Tito_Scwrl_2UWJ.pdb: