Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLSGGQKQRIAIARGLAMHPELLLFDEPTSALDPETIGDVLAVMQKL-AHDGMNMIIVTHEMGFAREVADRIIFMADGEVLVDTTDVDNFFDNPSEPRAQQFLSKIINHESDKVK 1L2T Chain:B ((146-223)) -LSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVVTHDINVAR-FGERIIYLKDGEV-----------------------------------

General information: TITO was launched using: RESULT: Template: 1L2T.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 235 -29888 -127.18 -388.15 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain B : 0.81 3D Compatibility (PKB) : -127.18 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.434

(partial model without unconserved sides chains): PDB file : Tito_1L2T.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1L2T-query.scw PDB file : Tito_Scwrl_1L2T.pdb: