Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNFNHVYFGYDENRP---VLKDITCSIFKGQKIAFVGPSGSGKSTIVRLLEQFYKPLSGDILMEQSSIYDFNLKEWRSKIAWVSQNNAVLSGSIRDNLCLGLNRLVTDDELMKVLDLVSLGDEIRSMKEGLDTEVGERGRLLSGGAKPKTSNS
2IXF Chain:C ((17-162))VKFQDVSFAYP-NHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHDFISGFPQGYDTEVGETGNQLSGGQR------


General information:
TITO was launched using:
RESULT:

Template: 2IXF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 457 9239 20.22 64.61
target 2D structure prediction score : 0.64
Monomeric hydrophicity matching model chain C : 0.83

3D Compatibility (PKB) : 20.22
2D Compatibility (Sec. Struct. Predict.) : 0.64
1D Compatibility (Hydrophobicity) : 0.83
QMean score : 0.496

(partial model without unconserved sides chains):
PDB file : Tito_2IXF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2IXF-query.scw
PDB file : Tito_Scwrl_2IXF.pdb: