Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSDAFTDVAKMKKIKEEIKAHEGQVVEMTLENGRKRQKNRLGKLIEVYPSLFIVEFGDVEGDKQVNVYVESFTYSDILTEKNLIHYLD 3VIE Chain:B ((116-151)) ---------SWETWEREIENYTRQIYRILEESQEQQDRNERDLLE-------------------------------------------

General information: TITO was launched using: RESULT: Template: 3VIE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 3 -514 -171.17 -14.26 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain B : 0.56 3D Compatibility (PKB) : -171.17 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.556

(partial model without unconserved sides chains): PDB file : Tito_3VIE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3VIE-query.scw PDB file : Tito_Scwrl_3VIE.pdb: