Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKMLAQLQNRFDQWVEQIVQYLDRLSVRERIMVVFTTIFVVVVIVGYSLWKMHSLAEQQQKRLNDLKDLMVWMQSNAVTMKPANELELDKSGKIQRVAQQQGLTVSSQQNGEQ-LQIVVTHQNYAILANFLIQLA--QMGLSIQKMEMVSSEGQIKLTATV 2W4D Chain:B ((15-76)) --------------------------------------------------------------------------------------GVGFRWSMQREARKLGVNGWVRNLPDGSVEAVLE-GDEERVEALIGWAHQGPPLARVTRVEVK------------

General information: TITO was launched using: RESULT: Template: 2W4D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 187 -3196 -17.09 -54.16 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain B : 0.53 3D Compatibility (PKB) : -17.09 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.568

(partial model without unconserved sides chains): PDB file : Tito_2W4D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2W4D-query.scw PDB file : Tito_Scwrl_2W4D.pdb: