Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNKSELIDAIA-EKGGVSKTDAGKALDATIASITEALKKGDTVTLVGFGTFSVKERAARTGRNPKTGEELQIKATKVPSFKAGKGLKDSVA
1OWG Chain:B ((1-88))MTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRD---


General information:
TITO was launched using:
RESULT:

Template: 1OWG.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 182 15795 86.78 181.55
target 2D structure prediction score : 0.64
Monomeric hydrophicity matching model chain B : 0.84

3D Compatibility (PKB) : 86.78
2D Compatibility (Sec. Struct. Predict.) : 0.64
1D Compatibility (Hydrophobicity) : 0.84
QMean score : 0.585

(partial model without unconserved sides chains):
PDB file : Tito_1OWG.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1OWG-query.scw
PDB file : Tito_Scwrl_1OWG.pdb: