Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSAVNFNMRLEAELKEQVTPILEDYGLTMPQAFKLFLNQIVKTKAIPLSFDYARETALTPKAAAKLLQSLKEIENGEYTEYETVEEAIKAMSEEAHG 3FT7 Chain:A ((8-51)) -NGIKLGVYIPQEWHDRLMEIAKEKNLTLSDVCRLAIKEYLDNHD----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3FT7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 58 -17580 -303.09 -399.53 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -303.09 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.670

(partial model without unconserved sides chains): PDB file : Tito_3FT7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3FT7-query.scw PDB file : Tito_Scwrl_3FT7.pdb: