Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --MFEFVMSEQPISPTVQLNTRGLRCPEPVMMLHQAIRKAKSGDVVEVLATDPSTSWDIPKFCMHLGHELLLKEEVLDEQNHKEYRYLVQKG- 1DCJ Chain:A ((1-81)) MT-------DLFSSPDHTLDALGLRCPEPVMMVRKTVRNMQPGETLLIIADDPATTRDIPGFCTFM-EHELVAKET---DG-LPYRYLIRKGG

General information: TITO was launched using: RESULT: Template: 1DCJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 388 10891 28.07 139.62 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.75 3D Compatibility (PKB) : 28.07 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.369

(partial model without unconserved sides chains): PDB file : Tito_1DCJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1DCJ-query.scw PDB file : Tito_Scwrl_1DCJ.pdb: