Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------MNFNIAKVMSIDQLETQIAELDNLPEHREIV----TFMRRSAPLNTSQRTALEQHRDLILEYPVGDLRQHFEHPERPLTVEIGFGMGRSLVLMAKANPERNYVGIEVHVPGIAQCVYEAGMAELKNLRVLDADAIQILREMPDNSI-----------------------NCVQLYFPDPWQKKRHFKR--------RFVIH----ERMQLVEQKLELGG------TFHAATDWEPYAEWMLDVLDNRPNLENLAGKGNS-YPRPEWRPVTKFERRGIESGHKINDFIFKKIK----------
5EQJ Chain:B ((4-376))NCFSGYKDLIKEGDLTLIWVSRDNIKPVRMHSEEVFNTRYGSFPHKDIIGKPYGSQIAIRTFAFVHVLQP--TPELWTLSLPTQIVYTPDSSYIMQRLNCSPHSRVIEAGTGSGSFSHAFARSVG--HLFSFEFH-----HIRYEQALEEFKEHGLIDDNVTITHRDVCQGGFLIKKGDTTSYEFGNNETAASLNANVVFLDLPAPWDAIPHLDSVISVDEKVGLCCFSPCIEQVDKTLDVLEKYGWTDVEMVEIQGRQYESRRQMVRSLNDALERLRDIKRHIKEGDSNYKWKEVTKMEAE-IKSHTSYLTFAFKVVNRSRDDEKVNE


General information:
TITO was launched using:
RESULT:

Template: 5EQJ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 1209 48595 40.19 205.91
target 2D structure prediction score : 0.49
Monomeric hydrophicity matching model chain B : 0.66

3D Compatibility (PKB) : 40.19
2D Compatibility (Sec. Struct. Predict.) : 0.49
1D Compatibility (Hydrophobicity) : 0.66
QMean score : 0.256

(partial model without unconserved sides chains):
PDB file : Tito_5EQJ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5EQJ-query.scw
PDB file : Tito_Scwrl_5EQJ.pdb: