Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------CFVAIVSDDPRGPVLASKRFEGNREVSFDGYDIVLELG-WDCYAIKKSGTIPHGYHINIASGVDEPRVGVCNVYNDRTEPRRRNLHTQPTSN--
2HFT Chain:? ((107-218))NLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDV-F-GKDLIYTLYYWKSSGKKTAKTNTNEFLIDVDKGENY-CFSVQAVIPSRTV--NRKSTDSPVECMG


General information:
TITO was launched using:
RESULT:

Template: 2HFT.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 320 24989 78.09 290.56
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain A : 0.67

3D Compatibility (PKB) : 78.09
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.67
QMean score : 0.372

(partial model without unconserved sides chains):
PDB file : Tito_2HFT.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2HFT-query.scw
PDB file : Tito_Scwrl_2HFT.pdb: