Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNICVGGELDGQKIEKEGRLLKASDIDPSFKTEYYKQIFNRDNINYQFWLPIGSDLHDMSEKVLNILRAPKN 3W7P Chain:B ((74-95)) ------------------------------------------NLGFDFYLKYASDLHDYSKKPL--------

General information: TITO was launched using: RESULT: Template: 3W7P.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 21 -3228 -153.69 -146.70 target 2D structure prediction score : 0.23 Monomeric hydrophicity matching model chain B : 0.69 3D Compatibility (PKB) : -153.69 2D Compatibility (Sec. Struct. Predict.) : 0.23 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.163

(partial model without unconserved sides chains): PDB file : Tito_3W7P.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3W7P-query.scw PDB file : Tito_Scwrl_3W7P.pdb: