Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMALTNEEILNAVAEKTVLELVELISAFEEKFNVSAAAVAVA--APAGG-A-AAAAEEQSEFNVELTSFGANKVAVIKAVREATGLGLKEAKDLVEGAP---QVL-KEGVSKEEGEELKKKLEEAGATVTLK
1DD3 Chain:A ((2-128))---TIDEIIEAIEKLTVSELAELVKKLEDKFGVTAAAPVAVAAAPVAGAAAGAAQEEKTEFDVVLKSFGQNKIQVIKVVREITGLGLKEAKDLVEKAGSPDA-VIKSGVSKEEAEEIKKKLEEAGAEVELK


General information:
TITO was launched using:
RESULT:

Template: 1DD3.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 348 21141 60.75 177.66
target 2D structure prediction score : 0.81
Monomeric hydrophicity matching model chain A : 0.84

3D Compatibility (PKB) : 60.75
2D Compatibility (Sec. Struct. Predict.) : 0.81
1D Compatibility (Hydrophobicity) : 0.84
QMean score : 0.680

(partial model without unconserved sides chains):
PDB file : Tito_1DD3.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1DD3-query.scw
PDB file : Tito_Scwrl_1DD3.pdb: