Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKPEYLIHAEHLTVILCPLEKQH-KILEHLKKEV---------L-------VAKLDNFAIIQKNWPMFPYLNLKDHVLLDVPEKE-----IKQDRLAYQEKLDISPSLLNCAAAELTSFEKVKLQLLHALLSKRNNIVIEDTFDELSVLEIQELLHLLSYLAHEENQGILLFTHDATIAQSPYIDRLEPAG
4TQU Chain:T ((22-206))-GVSLDIEPGEFVVLVGPSGCGKSTTLRMVAGLEEISGGTIRIDGRVINDLAPKDRDVAMVFQNYALYPHLNVRDNISFGLRLKRTKKSVIDAAVKTAADILGLQP-LLERKPSDLSGGQRQRVAMGRAIVRDPKVFLFDQPLSNLDAKLRTQMRAEIKRLHQRLGTTVIYVTHDQVEAMT-LADRIV---


General information:
TITO was launched using:
RESULT:

Template: 4TQU.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 578 6274 10.85 38.49
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain T : 0.69

3D Compatibility (PKB) : 10.85
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.69
QMean score : 0.518

(partial model without unconserved sides chains):
PDB file : Tito_4TQU.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4TQU-query.scw
PDB file : Tito_Scwrl_4TQU.pdb: