Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence DTNSQQFIQVRRLPGHVMGAVVRGSGCEFTLIKKNHKPMVQKI----VDTSGDLDSNWKSIKIPFCGMTFNWACNPIDHGQWKFHSITKDGKHQYIDVNALQV 2JUB Chain:A ((1-76)) ATLTSEVIKANK--------------------GREGKPMISLVDGEEIKGTVYLGDGWSAKKD---GATIVISPAE-ETALFKAKHIS-AAHLKIIAKNLL--

General information: TITO was launched using: RESULT: Template: 2JUB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 255 14579 57.17 202.48 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.65 3D Compatibility (PKB) : 57.17 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.239

(partial model without unconserved sides chains): PDB file : Tito_2JUB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JUB-query.scw PDB file : Tito_Scwrl_2JUB.pdb: