Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGKISGQEAVQQLQPPE-DGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHY 1ZFP Chain:E ((5-80)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 1ZFP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 260 -23691 -91.12 -315.87 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain E : 0.74 3D Compatibility (PKB) : -91.12 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.544

(partial model without unconserved sides chains): PDB file : Tito_1ZFP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ZFP-query.scw PDB file : Tito_Scwrl_1ZFP.pdb: