Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLD-----GAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY
1AOU Chain:F ((7-89))WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHY


General information:
TITO was launched using:
RESULT:

Template: 1AOU.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 299 5037 16.84 64.57
target 2D structure prediction score : 0.53
Monomeric hydrophicity matching model chain F : 0.86

3D Compatibility (PKB) : 16.84
2D Compatibility (Sec. Struct. Predict.) : 0.53
1D Compatibility (Hydrophobicity) : 0.86
QMean score : 0.503

(partial model without unconserved sides chains):
PDB file : Tito_1AOU.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1AOU-query.scw
PDB file : Tito_Scwrl_1AOU.pdb: