Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------MYDLHDIVEMKKPHACQTNRWEVIRMGADIKIRCMNCGHIVMMTRRDFE------------KKLKKVIEKNAEKE-- 1V74 Chain:B ((1-87)) MNKMAMIDLAKLFLASKITAIEFSERICVERRRLYGVK---DLSPNILNCGEELFMAAERFEPDADRANYEIDDNGLKVEVRSILEKFKL

General information: TITO was launched using: RESULT: Template: 1V74.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 160 12969 81.06 216.15 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain B : 0.65 3D Compatibility (PKB) : 81.06 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.344

(partial model without unconserved sides chains): PDB file : Tito_1V74.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1V74-query.scw PDB file : Tito_Scwrl_1V74.pdb: