Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTQSVYHIPVKTISGE-TVDLDQYKGKVLLIVNTASKCGLTPQYEGLEKLYQAKKDQGLEILGFPANNFKEQEPGSDEEIQQFCSLN------YDVHFPLFSKISVAGEDKHPLYQALTTAQPERIGEGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVIARFAPNLTADDEQIVKAVEAELAK
2R37 Chain:B ((14-192))-SGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYGGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLK-YVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSE-LLG--TSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSN--VKMDILSYM--


General information:
TITO was launched using:
RESULT:

Template: 2R37.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 861 14398 16.72 83.71
target 2D structure prediction score : 0.63
Monomeric hydrophicity matching model chain B : 0.73

3D Compatibility (PKB) : 16.72
2D Compatibility (Sec. Struct. Predict.) : 0.63
1D Compatibility (Hydrophobicity) : 0.73
QMean score : 0.543

(partial model without unconserved sides chains):
PDB file : Tito_2R37.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2R37-query.scw
PDB file : Tito_Scwrl_2R37.pdb: