Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------------------------------------------------------------------------------------DTNSQQFIQVRRLPGHVMGAVVRGSGCEFTLIKKNHKPMVQKIVDTSGDLDSNWK---SIKI---PFCGMTFNWACNPIDHGQWKFHSITK-DGKHQYIDVNALQV---
1M1G Chain:A ((9-248))LEKKWYALQVEPGKENEAKENLLKVLELEGLKDLVDEVIVPAEEKVVIRAQGKEKYRLSLKGNARDISVLGKKGVTTFRIENGEVKVVESVEGDTCVNAPPISKPGQKITCKENKTEAKIVLDNKIFPGYILIKAHMNDKLLMAIEKTPH-VFR-PVMVGGKPVPLKEEEVQNILNQIKRGVKPSKVEFEKGDQVRVIEGPFMNFTGT--VEEVHPEKRKLTVMISIFGRMTPVELDFDQVEKI


General information:
TITO was launched using:
RESULT:

Template: 1M1G.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 228 -898 -3.94 -9.45
target 2D structure prediction score : 0.68
Monomeric hydrophicity matching model chain A : 0.62

3D Compatibility (PKB) : -3.94
2D Compatibility (Sec. Struct. Predict.) : 0.68
1D Compatibility (Hydrophobicity) : 0.62
QMean score : 0.334

(partial model without unconserved sides chains):
PDB file : Tito_1M1G.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1M1G-query.scw
PDB file : Tito_Scwrl_1M1G.pdb: