Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKVLRVLVTTTALLAAGAAMADEAVVHDSYAFDKNQLIPVGARAEVGTTGYGGALLWQANPYVGLALGYNGGDISWTDDVSVNGTKYDLDMDNNNVYLNAEIRPWGASTNPWAQGLYIAAGAAYLDNDYDLAKRIGNGDTLSIDGKNYQQAVPGQEGGVRGKMSYKNDIAPYLGFGFAPKI-S----------KNWGVFGEVGAYYTGNPKVELTQYNLASVTGNPTSAQDAVDKEANEIRNDNKYEWMPVGKVGVNFYW 4RLC Chain:A ((97-153)) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------VGLRPYVSAGLAHQNITNINSDSQGRQQMTMANIGAGLKYYFTENFFAKAS-------------------------------------------

General information: TITO was launched using: RESULT: Template: 4RLC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 74 800 10.80 19.99 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : 10.80 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.271

(partial model without unconserved sides chains): PDB file : Tito_4RLC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4RLC-query.scw PDB file : Tito_Scwrl_4RLC.pdb: