Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQGQVYPYVTLDISSASHPFYTGEVRQASNEGRVASFNKRFARFNRKS 3VRC Chain:A ((118-129)) ----------------------------------------------GAACKACHQKYR--------------------------

General information: TITO was launched using: RESULT: Template: 3VRC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 3 -554 -184.67 -46.17 target 2D structure prediction score : 0.25 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -184.67 2D Compatibility (Sec. Struct. Predict.) : 0.25 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.685

(partial model without unconserved sides chains): PDB file : Tito_3VRC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3VRC-query.scw PDB file : Tito_Scwrl_3VRC.pdb: