Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------------------------------------------------------------------MAYTASCLCNGIQLRINAELEPIMVCHCKQCQKAQG---AAFAAITQVQKSDLEIVQGENLLQAYFA----SPNKKRVFCKICGSPVW---SERLDKPDVVRLRVGLINEEISTPVIS------HAFVNSQVKWYPICDTARQYPNGVENP----------------------------
2MHK Chain:A ((1-250))MGSSHHHHHHSSGLVPRGSHMGTHTPDQSTAYMQGTAQADSAFYLQQMQQSSDDTRINWQLLAIRALVKEGKTGQAVELFNQLPQELNDAQRREKTLLAVEIKLAQKDFAGAQNLLAKITPADLEQNQQARYWQAKIDASQGRPSIDLLRALIAQEPLLGAKEKQQNIDATWQALSSMTQEQANTLVINADENILQGWLDLQRVWFDNRNDPDMMKAGIADWQKRYPNNPGAKMLPTQLVNVKAFKPAST


General information:
TITO was launched using:
RESULT:

Template: 2MHK.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 545 16246 29.81 120.34
target 2D structure prediction score : 0.44
Monomeric hydrophicity matching model chain A : 0.62

3D Compatibility (PKB) : 29.81
2D Compatibility (Sec. Struct. Predict.) : 0.44
1D Compatibility (Hydrophobicity) : 0.62
QMean score : 0.132

(partial model without unconserved sides chains):
PDB file : Tito_2MHK.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2MHK-query.scw
PDB file : Tito_Scwrl_2MHK.pdb: