Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAKFRIDLLRHGESQY--SHTLRGHLDDELTAKGWQQMQATIEQVSN--QPWDVIVSSSLKRCVCFAEQLAKTAEL---PLLVNHDLKEMYFGEWEGISTQQIYETSPEL-LANFWQK------------------------PSQYCPPRAETLDQFQTRVLKGFQDLLEHMQKQNLQHALVVTHGGVIKLLACLARQQPLDDLLKMPAELGKLYSLEFSETDSQLTFKLR
4EMB Chain:A ((26-249))-FMYKLVLVRHGESEWNKENLFTGWTDVKLSDKGIDEAVEAGLLLKQEGYSFDIAFSSLLSRANDTLNIILRELGQSYISVKKTWRLNERHYGALQGLNKSETAAKYGEDKVLIWRRSYDVPPMSLDESDDRHPIKDPRYKHIPKRELPSTECLKDTVARVIPYWTDEIAKEV-LEGKKVIVAAHGNSLRALVKYFDNLSEEDVLKLNIPTGIPLVYELDKDLNPI-----


General information:
TITO was launched using:
RESULT:

Template: 4EMB.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 943 16840 17.86 87.71
target 2D structure prediction score : 0.71
Monomeric hydrophicity matching model chain A : 0.68

3D Compatibility (PKB) : 17.86
2D Compatibility (Sec. Struct. Predict.) : 0.71
1D Compatibility (Hydrophobicity) : 0.68
QMean score : 0.515

(partial model without unconserved sides chains):
PDB file : Tito_4EMB.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4EMB-query.scw
PDB file : Tito_Scwrl_4EMB.pdb: