Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------CLGVLLRNDGRKPILGF---EPFRIRRTVSFPGYDFVLKVGRRCITEKISGTIPPHLHVHVVW------GFPAPVRPVCNVYNGWTERFERYGRNVREAPW-
3I4S Chain:A ((7-140))AWSLHSRLKEDTIDIGDLPLSKVLVIKDANYPWLLLVPRRPDAVEIIDLDEVQQAQLMTEISRVSRALKEITKCDKLNIAALGNLVPQLHVHIIARRTGDAAWPRPVWGVMQPLAHDATEVQNFISALRRKIWL


General information:
TITO was launched using:
RESULT:

Template: 3I4S.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 333 4257 12.78 46.27
target 2D structure prediction score : 0.55
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : 12.78
2D Compatibility (Sec. Struct. Predict.) : 0.55
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.171

(partial model without unconserved sides chains):
PDB file : Tito_3I4S.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3I4S-query.scw
PDB file : Tito_Scwrl_3I4S.pdb: