Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTEKEIFDRIVTIIQERQG-EDFVVTESLSLKDDLDADSVDLMEFILTLEDEFSIEISDEEIDQLQNVGDVVKIIQGK 4KEH Chain:C ((3-75)) -----IEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH

General information: TITO was launched using: RESULT: Template: 4KEH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 255 9542 37.42 132.52 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain C : 0.80 3D Compatibility (PKB) : 37.42 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.523

(partial model without unconserved sides chains): PDB file : Tito_4KEH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4KEH-query.scw PDB file : Tito_Scwrl_4KEH.pdb: