Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMKMATDKNRIMISLDDKNLEKLENLVEDVRDRRGMRLTKSQVIELLLNTVDYFDDIMGAIYSKK 2GPE Chain:D ((2-39)) ------GTTTMGVKLDDATRERIKSAAT----RID--RTPHWLIKQAIFS---------------

General information: TITO was launched using: RESULT: Template: 2GPE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 55 -10577 -192.31 -278.34 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain D : 0.56 3D Compatibility (PKB) : -192.31 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.802

(partial model without unconserved sides chains): PDB file : Tito_2GPE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2GPE-query.scw PDB file : Tito_Scwrl_2GPE.pdb: