Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKMLAQLQNRFDQWVEQIVQYLDRLSVRERIMVVFTTIFVVVVIVGYSLWKMHSLAEQQQKRLNDLKDLMVWMQSNAVTMKPANELELDKSGKIQRVAQQQGLTVSSQQNGEQ--LQIVVTHQNYAILANFLIQLA--QMGLSIQKMEMVSSEGQIKLTATV 4HI1 Chain:C ((16-78)) --------------------------------------------------------------------------------------GVGFRYHTSHQGLKLGLTGY-AKNLNNGDVEVVAC-GTPERLEELYLWLQEGPKTASVRQVRRLS-----------

General information: TITO was launched using: RESULT: Template: 4HI1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 191 -1913 -10.02 -32.42 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain C : 0.56 3D Compatibility (PKB) : -10.02 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.516

(partial model without unconserved sides chains): PDB file : Tito_4HI1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4HI1-query.scw PDB file : Tito_Scwrl_4HI1.pdb: