Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTPTQNVPEDRIQIGQLRSAYGLNGWLWVYSNTEPMSNMFDYLPWYIETKAGWQIVDVKRWKPHGKGLVVALKGVSDRTGAESLVGANIWIAKSQLPKADVDEYYWSDLKGLTVLGLDDDEQEVNLGQIHELFETG-AN--DVMVVRATPDSIDSEERMIPWHKDVVQRVDLEAGRIYVNWGVDY 3V3Z Chain:H ((136-186)) ---------------------------------------------------------------------------------------------------------GKNPIGLPVRGCDL----EIAGKVVDIWVDIPEQMARFLEVELK----DGSTRLLPMQM---------------------

General information: TITO was launched using: RESULT: Template: 3V3Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 126 -4305 -34.16 -89.68 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain H : 0.54 3D Compatibility (PKB) : -34.16 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.463

(partial model without unconserved sides chains): PDB file : Tito_3V3Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3V3Z-query.scw PDB file : Tito_Scwrl_3V3Z.pdb: