Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence DCIISRYKDGDVNNMYTANRNEEITIEEYKVFVNEACHPYPVILPDRSVLSGDF-TSAYADDDESC 1GYF Chain:A ((25-86)) D-VMWEYKW---ENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

General information: TITO was launched using: RESULT: Template: 1GYF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 209 -6557 -31.37 -107.49 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -31.37 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.286

(partial model without unconserved sides chains): PDB file : Tito_1GYF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1GYF-query.scw PDB file : Tito_Scwrl_1GYF.pdb: