Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHKKVEKRTSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYYLTDNLTFSSIYALIQHY 4K45 Chain:A ((8-81)) WYHASL-TRAQAEHMLMRV-----PRDGAFLVRKRNE-PNSYAISFRAEGKIKHCRVQQ--EGQTV---MLGNSEFDSLVDLISYY

General information: TITO was launched using: RESULT: Template: 4K45.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 262 -42252 -161.27 -570.97 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.78 3D Compatibility (PKB) : -161.27 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.738

(partial model without unconserved sides chains): PDB file : Tito_4K45.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4K45-query.scw PDB file : Tito_Scwrl_4K45.pdb: