Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------MNGMKAKKMWMAGLALLGIGSLALATKKVADDRKLMKTQEELTEI-------VRDHFSDMGEIATLYVQVYESSLESLVGGVIFEDGRHYTFVYENEDLVYEEEVL--
5J9T Chain:D ((1-119))MDPSLVLEQTIQDVSNLPSEFRYLLEEIGSNDLKLIEEKKKYEQKESQIHKFIRQQGSIPKHPQEDGLDKEIKESLLKCQSLQREKCVLANTALFLIARHLNKLEKNIALLEEDGVLAP


General information:
TITO was launched using:
RESULT:

Template: 5J9T.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 168 5326 31.70 53.80
target 2D structure prediction score : 0.72
Monomeric hydrophicity matching model chain D : 0.60

3D Compatibility (PKB) : 31.70
2D Compatibility (Sec. Struct. Predict.) : 0.72
1D Compatibility (Hydrophobicity) : 0.60
QMean score : 0.264

(partial model without unconserved sides chains):
PDB file : Tito_5J9T.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5J9T-query.scw
PDB file : Tito_Scwrl_5J9T.pdb: