Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQGQVYPYVTLDISSASHPFY-TGEVRQASNEGRVASFNKRFARFNRKS 3QVE Chain:A ((92-104)) ------------------------------------------------ECKLDHPFYVKNK------------------------

General information: TITO was launched using: RESULT: Template: 3QVE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 3 -453 -151.00 -37.75 target 2D structure prediction score : 0.92 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : -151.00 2D Compatibility (Sec. Struct. Predict.) : 0.92 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 1.214

(partial model without unconserved sides chains): PDB file : Tito_3QVE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3QVE-query.scw PDB file : Tito_Scwrl_3QVE.pdb: