Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------MSEQTIELTPTRPYLARAIYEWICDNQLTS-YLLVDATQPHT-DVPQQFVKDGQIVLN------IVPHAVHQLLISNDAITFSA--------RFGGVSK-DIYVPIQAVLGIYARENGQGLFFDPEEYANVAPVEDKLDSEKQETSEPTKKKPTLRILD----------------------------------------------------------------
5CMN Chain:E ((3-260))LCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYD------KRSASNAFMICGILYVVKSNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDF


General information:
TITO was launched using:
RESULT:

Template: 5CMN.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 569 9449 16.61 69.48
target 2D structure prediction score : 0.46
Monomeric hydrophicity matching model chain E : 0.61

3D Compatibility (PKB) : 16.61
2D Compatibility (Sec. Struct. Predict.) : 0.46
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.104

(partial model without unconserved sides chains):
PDB file : Tito_5CMN.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5CMN-query.scw
PDB file : Tito_Scwrl_5CMN.pdb: