Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------GCE----VLISKKSGGDGP-----VKSSCIPKSGSKVI-VINGKTVTVSADGSCKFSSKDLDPSL---AMKFEGDCIGI-- 7TAA Chain:? ((382-476)) YKNWPIYKDDTTIAMRKGTDGSQIVTILSNKGASGDSYTLSLSGAGY-TAGQQLTEVIGCTTVTVGSDGNVPVPMAGGLPRVLYPTEKLAGS--KICS

General information: TITO was launched using: RESULT: Template: 7TAA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 165 7092 42.98 112.57 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 42.98 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.607

(partial model without unconserved sides chains): PDB file : Tito_7TAA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-7TAA-query.scw PDB file : Tito_Scwrl_7TAA.pdb: