Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLILTRRVGETLMIGDQVSVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQHERAMHEHLQHLDQDYQVSYEDDNYAQKNFNR 2MF1 Chain:E ((1-59)) MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQAGLTAPD-------------------------

General information: TITO was launched using: RESULT: Template: 2MF1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 111 -20852 -187.85 -353.42 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain E : 0.85 3D Compatibility (PKB) : -187.85 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.552

(partial model without unconserved sides chains): PDB file : Tito_2MF1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MF1-query.scw PDB file : Tito_Scwrl_2MF1.pdb: