Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKDFYSVNELAEQLGVTTRSIRNYLHEGKLKGTK-VGGQWKFSERNLFEFLYGDQAEEAAKEMQRFMLNAPITMRFNLQYRDFTAINQFREQLVQYHNDVYANKKDRLLQYDLYKDNHAEILIGGNFNYVVNFSQWINEKLLIQTDISLVS 2ZHG Chain:A ((10-65)) --ALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRYKRDVLRYVAII--------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2ZHG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 171 -17968 -105.07 -359.35 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -105.07 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.879

(partial model without unconserved sides chains): PDB file : Tito_2ZHG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZHG-query.scw PDB file : Tito_Scwrl_2ZHG.pdb: