Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEATYSFTSQLSQGDGFKTLEEGQAVTFDVEESDRGPQAANVVKA 3CAM Chain:B ((25-67)) -EDLFAHFSAIN-MEGFKTLKEGQRVSFDVTTGPKGKQAANIQAA

General information: TITO was launched using: RESULT: Template: 3CAM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 52 -4342 -83.50 -100.98 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain B : 0.80 3D Compatibility (PKB) : -83.50 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.488

(partial model without unconserved sides chains): PDB file : Tito_3CAM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3CAM-query.scw PDB file : Tito_Scwrl_3CAM.pdb: