Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence PPGSVDPRGPERPVSPGTLAEDADSPARPCKVTISMAVSPGGYFRQIYGEGLTTRGGRVAIENFKCTVDETCNNPSCPDVPPTWQVTSYDVEKKLEGLGEQGGESVWGVGKKHEL 3OR1 Chain:B ((214-272)) ---------------------DHENLAELCEIPLAVAACPTAAVKPITAEVNGQKVKSVAINNDRCMYCGNCYT-MCPALP----------------------------------

General information: TITO was launched using: RESULT: Template: 3OR1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 219 -24495 -111.85 -415.16 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain B : 0.67 3D Compatibility (PKB) : -111.85 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.135

(partial model without unconserved sides chains): PDB file : Tito_3OR1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3OR1-query.scw PDB file : Tito_Scwrl_3OR1.pdb: