Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence SSSDTDSDSSPDRGLSRMCCVYKIHPGGNIWSTKKGEQAWFRRRFSKYEVMAYDRCNLEWGFSGKP--RGLTFEFLWDKEAAADGTC 2FSX Chain:A ((11-66)) -------------------------------------QAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSSLGREVVYVEWATSDGT-

General information: TITO was launched using: RESULT: Template: 2FSX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 117 -3712 -31.73 -78.98 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -31.73 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.239

(partial model without unconserved sides chains): PDB file : Tito_2FSX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2FSX-query.scw PDB file : Tito_Scwrl_2FSX.pdb: