Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTKPPYHDDQASFSAPIEDLQVRIAFLDDLVEELNQQLAIQTLEIADLKKQMQLLYQRVESADL--SEGVAPFDPLTNKPPHY 1YIG Chain:A ((190-241)) ---------------------------DDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQR----

General information: TITO was launched using: RESULT: Template: 1YIG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 12 2067 172.21 41.33 target 2D structure prediction score : 0.98 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 172.21 2D Compatibility (Sec. Struct. Predict.) : 0.98 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.543

(partial model without unconserved sides chains): PDB file : Tito_1YIG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1YIG-query.scw PDB file : Tito_Scwrl_1YIG.pdb: