Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNKLLVALGLAATVALVGCNKDKAPETGATTGEHLENSAQQASADIKSAGDQAASDIATATDNASAKIDAATDH--AADATAKAAAETEATARKATADTAQAVENAAADVKKDAQH 2FY2 Chain:A ((438-503)) ------------------------------------------SASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLLKDAI-RAQTAYTVMAITGMAID-------

General information: TITO was launched using: RESULT: Template: 2FY2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 155 5901 38.07 92.20 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : 38.07 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.336

(partial model without unconserved sides chains): PDB file : Tito_2FY2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2FY2-query.scw PDB file : Tito_Scwrl_2FY2.pdb: